Apolipoprotein M Human, Sheep Polyclonal Antibody

Artikelnummer: BVD-RD184129100
Artikelname: Apolipoprotein M Human, Sheep Polyclonal Antibody
Artikelnummer: BVD-RD184129100
Hersteller Artikelnummer: RD184129100
Alternativnummer: BVD-RD184129100-0.1
Hersteller: BioVendor
Wirt: Sheep
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Alternative Synonym: Apo M, Protein G3a, G3a, G3A, NG20
Polyclonal Antibody
Apolipoprotein M Human, Sheep Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Apolipoprotein M Human, Sheep Polyclonal Antibody
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **HVDYKDDDDKPAG**CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Apolipoprotein M
Kommentar: This product is for research use only.
Application Verdünnung: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.