Decorin Human, Sheep Polyclonal Antibody

Artikelnummer: BVD-RD184324100
Artikelname: Decorin Human, Sheep Polyclonal Antibody
Artikelnummer: BVD-RD184324100
Hersteller Artikelnummer: RD184324100
Alternativnummer: BVD-RD184324100-0.1
Hersteller: BioVendor
Wirt: Sheep
Kategorie: Antikörper
Spezies Reaktivität: Human
Alternative Synonym: Bone proteoglycan II, PG-S2, PG40, DCN, SLRR1B
Polyclonal Antibody
Decorin Human, Sheep Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Decorin Human, Sheep Polyclonal Antibody
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **MKHHHHHHAS**DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPH
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Decorin
Application Verdünnung: Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.