Granulysin Human, Sheep Polyclonal Antibody

Artikelnummer: BVD-RD184327100
Artikelname: Granulysin Human, Sheep Polyclonal Antibody
Artikelnummer: BVD-RD184327100
Hersteller Artikelnummer: RD184327100
Alternativnummer: BVD-RD184327100-0.1
Hersteller: BioVendor
Wirt: Sheep
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Alternative Synonym: Lymphokine LAG-2, T-cell activation protein 519, GNLY, LAG2, NKG5, TLA519
Polyclonal Antibody
Granulysin Human, Sheep Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Granulysin Human, Sheep Polyclonal Antibody
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **MKHHHHHHAS**RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Granulysin
Application Verdünnung: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.