Procalcitonin Canine, Rabbit Polyclonal Antibody

Artikelnummer: BVD-RD481488100
Artikelname: Procalcitonin Canine, Rabbit Polyclonal Antibody
Artikelnummer: BVD-RD481488100
Hersteller Artikelnummer: RD481488100
Alternativnummer: BVD-RD481488100-0.1
Hersteller: BioVendor
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Canine
Alternative Synonym: PCT
Polyclonal Antibody
Procalcitonin Canine, Rabbit Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Procalcitonin Canine, Rabbit Polyclonal Antibody
Isotyp: IgG
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **MKHHHHHHAS**APFRSALEGLPDPTALSEKEGRLLLAALVKAYVQRKNELEQEQEQETEGSSLDSSRAKRCSNLSTCVLGTYSKDLNNFHTFSGIGFGAETPGKKRDIASGLERGR
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Procalcitonin
Kommentar: This product is for research use only.
Application Verdünnung: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.