RecombinantDCIP-1/CXCL3,Mouse

Artikelnummer: BWT-BK0192
Artikelname: RecombinantDCIP-1/CXCL3,Mouse
Artikelnummer: BWT-BK0192
Hersteller Artikelnummer: BK0192
Alternativnummer: BWT-BK0192-10UG,BWT-BK0192-1MG,BWT-BK0192-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect
Molekulargewicht: 8 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.