RecombinantEGF,Rat(CHO-expressed)

Artikelnummer: BWT-BK0196
Artikelname: RecombinantEGF,Rat(CHO-expressed)
Artikelnummer: BWT-BK0196
Hersteller Artikelnummer: BK0196
Alternativnummer: BWT-BK0196-10UG,BWT-BK0196-1MG,BWT-BK0196-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Recept
Molekulargewicht: ~6 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.