RecombinantEpigen,Human(CHO-expressed)

Artikelnummer: BWT-BK0197
Artikelname: RecombinantEpigen,Human(CHO-expressed)
Artikelnummer: BWT-BK0197
Hersteller Artikelnummer: BK0197
Alternativnummer: BWT-BK0197-10UG,BWT-BK0197-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human
Molekulargewicht: 15~20 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.