RecombinantFGF-16,Human

Artikelnummer: BWT-BK0199
Artikelname: RecombinantFGF-16,Human
Artikelnummer: BWT-BK0199
Hersteller Artikelnummer: BK0199
Alternativnummer: BWT-BK0199-10UG,BWT-BK0199-1MG,BWT-BK0199-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparinbinding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF fam
Molekulargewicht: 23 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTV HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY YVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.