RecombinantFlt-3L,Human

Artikelnummer: BWT-BK0203
Artikelname: RecombinantFlt-3L,Human
Artikelnummer: BWT-BK0203
Hersteller Artikelnummer: BK0203
Alternativnummer: BWT-BK0203-10UG,BWT-BK0203-1MG,BWT-BK0203-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth fa
Molekulargewicht: Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.