RecombinantGCP-2/CXCL6,Human

Artikelnummer: BWT-BK0205
Artikelname: RecombinantGCP-2/CXCL6,Human
Artikelnummer: BWT-BK0205
Hersteller Artikelnummer: BK0205
Alternativnummer: BWT-BK0205-25UG,BWT-BK0205-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human
Molekulargewicht: 9 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.