RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)

Artikelnummer: BWT-BK0216
Artikelname: RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)
Artikelnummer: BWT-BK0216
Hersteller Artikelnummer: BK0216
Alternativnummer: BWT-BK0216-1MG,BWT-BK0216-25UG,BWT-BK0216-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemok
Molekulargewicht: 5-7 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.