RecombinantHB-EGF,Human

Artikelnummer: BWT-BK0218
Artikelname: RecombinantHB-EGF,Human
Artikelnummer: BWT-BK0218
Hersteller Artikelnummer: BK0218
Alternativnummer: BWT-BK0218-1MG,BWT-BK0218-25UG,BWT-BK0218-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to sti
Molekulargewicht: 12-14 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.