RecombinantHCC-4/CCL16,Human(CHO-expressed)

Artikelnummer: BWT-BK0219
Artikelname: RecombinantHCC-4/CCL16,Human(CHO-expressed)
Artikelnummer: BWT-BK0219
Hersteller Artikelnummer: BK0219
Alternativnummer: BWT-BK0219-10UG,BWT-BK0219-1MG,BWT-BK0219-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal th
Molekulargewicht: 12 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.