RecombinantI-309/CCL1,Human(CHO-expressed)

Artikelnummer: BWT-BK0221
Artikelname: RecombinantI-309/CCL1,Human(CHO-expressed)
Artikelnummer: BWT-BK0221
Hersteller Artikelnummer: BK0221
Alternativnummer: BWT-BK0221-10UG,BWT-BK0221-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only app
Molekulargewicht: 15 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.