RecombinantIFN-gamma,Rat(CHO-expressed)

Artikelnummer: BWT-BK0224
Artikelname: RecombinantIFN-gamma,Rat(CHO-expressed)
Artikelnummer: BWT-BK0224
Hersteller Artikelnummer: BK0224
Alternativnummer: BWT-BK0224-10UG,BWT-BK0224-1MG,BWT-BK0224-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interferon-gamma (IFN-gamma), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-gamma is an antiparallel dimer that interacts with the receptor IFN-gammaR1 and sets o
Molekulargewicht: 15-25 kDa, observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITN FFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.