RecombinantIL-10,Human(CHO-expressed)

Artikelnummer: BWT-BK0225
Artikelname: RecombinantIL-10,Human(CHO-expressed)
Artikelnummer: BWT-BK0225
Hersteller Artikelnummer: BK0225
Alternativnummer: BWT-BK0225-10UG,BWT-BK0225-1MG,BWT-BK0225-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, ma
Molekulargewicht: 18-19 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQA ENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.