RecombinantIL-17A,His,Human

Artikelnummer: BWT-BK0234
Artikelname: RecombinantIL-17A,His,Human
Artikelnummer: BWT-BK0234
Hersteller Artikelnummer: BK0234
Alternativnummer: BWT-BK0234-10UG,BWT-BK0234-1MG,BWT-BK0234-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with r
Molekulargewicht: 14-22 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.