RecombinantIL-17A,Mouse

Artikelnummer: BWT-BK0235
Artikelname: RecombinantIL-17A,Mouse
Artikelnummer: BWT-BK0235
Hersteller Artikelnummer: BK0235
Alternativnummer: BWT-BK0235-10UG,BWT-BK0235-1MG,BWT-BK0235-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mo
Molekulargewicht: 15-22 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNA EGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.