RecombinantIL-1beta,Human(CHO-expressed)

Artikelnummer: BWT-BK0238
Artikelname: RecombinantIL-1beta,Human(CHO-expressed)
Artikelnummer: BWT-BK0238
Hersteller Artikelnummer: BK0238
Alternativnummer: BWT-BK0238-10UG,BWT-BK0238-1MG,BWT-BK0238-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical b
Molekulargewicht: 17kDa, observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.