RecombinantIL-3,His,Rat

Artikelnummer: BWT-BK0242
Artikelname: RecombinantIL-3,His,Rat
Artikelnummer: BWT-BK0242
Hersteller Artikelnummer: BK0242
Alternativnummer: BWT-BK0242-10UG,BWT-BK0242-1MG,BWT-BK0242-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe alpha-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alp
Molekulargewicht: 22-34 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.