RecombinantIL-9,Human

Artikelnummer: BWT-BK0259
Artikelname: RecombinantIL-9,Human
Artikelnummer: BWT-BK0259
Hersteller Artikelnummer: BK0259
Alternativnummer: BWT-BK0259-10UG,BWT-BK0259-1MG,BWT-BK0259-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a vari
Molekulargewicht: 25-40 kDa, observed by non-reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.