RecombinantMCP-3/MARC/CCL7,Mouse

Artikelnummer: BWT-BK0265
Artikelname: RecombinantMCP-3/MARC/CCL7,Mouse
Artikelnummer: BWT-BK0265
Hersteller Artikelnummer: BK0265
Alternativnummer: BWT-BK0265-10UG,BWT-BK0265-1MG,BWT-BK0265-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3). Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chem
Molekulargewicht: 8~12 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEE AIAYLDMKTPTPKP
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.