RecombinantMIP-1beta/CCL4,Human

Artikelnummer: BWT-BK0271
Artikelname: RecombinantMIP-1beta/CCL4,Human
Artikelnummer: BWT-BK0271
Hersteller Artikelnummer: BK0271
Alternativnummer: BWT-BK0271-1MG,BWT-BK0271-25UG,BWT-BK0271-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Macrophage inflammatory protein 1 beta (MIP-1beta), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cel
Molekulargewicht: 10-19 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.