RecombinantMIP-3alpha/CCL20,Human(CHO-expressed)

Artikelnummer: BWT-BK0272
Artikelname: RecombinantMIP-3alpha/CCL20,Human(CHO-expressed)
Artikelnummer: BWT-BK0272
Hersteller Artikelnummer: BK0272
Alternativnummer: BWT-BK0272-1MG,BWT-BK0272-25UG,BWT-BK0272-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and w
Molekulargewicht: 8 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.