RecombinantMPIF-1/CCL23,Human

Artikelnummer: BWT-BK0274
Artikelname: RecombinantMPIF-1/CCL23,Human
Artikelnummer: BWT-BK0274
Hersteller Artikelnummer: BK0274
Alternativnummer: BWT-BK0274-10UG,BWT-BK0274-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Myeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow an
Molekulargewicht: 12 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.