RecombinantNAP-2/CXCL7,Human(CHO-expressed)

Artikelnummer: BWT-BK0275
Artikelname: RecombinantNAP-2/CXCL7,Human(CHO-expressed)
Artikelnummer: BWT-BK0275
Hersteller Artikelnummer: BK0275
Alternativnummer: BWT-BK0275-10UG,BWT-BK0275-1MG,BWT-BK0275-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is
Molekulargewicht: 9 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.