RecombinantOTOR,Human

Artikelnummer: BWT-BK0280
Artikelname: RecombinantOTOR,Human
Artikelnummer: BWT-BK0280
Hersteller Artikelnummer: BK0280
Alternativnummer: BWT-BK0280-10UG,BWT-BK0280-1MG,BWT-BK0280-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3)-like domain. OTOR appears to be involv
Molekulargewicht: 14-15 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENG AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.