RecombinantThymusChemokine-1/CXCL7,Rat

Artikelnummer: BWT-BK0286
Artikelname: RecombinantThymusChemokine-1/CXCL7,Rat
Artikelnummer: BWT-BK0286
Hersteller Artikelnummer: BK0286
Alternativnummer: BWT-BK0286-1MG,BWT-BK0286-25UG,BWT-BK0286-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Thymus Chemokine-1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7) , is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine-1 has been shown to bind CXCR-2 and be
Molekulargewicht: 9.8 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 97% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.