RecombinantTWEAK,Human

Artikelnummer: BWT-BK0290
Artikelname: RecombinantTWEAK,Human
Artikelnummer: BWT-BK0290
Hersteller Artikelnummer: BK0290
Alternativnummer: BWT-BK0290-10UG,BWT-BK0290-1MG,BWT-BK0290-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and per
Molekulargewicht: 20-22 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.