RecombinantAdiponectin/Acrp30,Human

Artikelnummer: BWT-BK0296
Artikelname: RecombinantAdiponectin/Acrp30,Human
Artikelnummer: BWT-BK0296
Hersteller Artikelnummer: BK0296
Alternativnummer: BWT-BK0296-10UG,BWT-BK0296-1MG,BWT-BK0296-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on m
Molekulargewicht: 16~17 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.