RecombinantBetacellulin,Human

Artikelnummer: BWT-BK0298
Artikelname: RecombinantBetacellulin,Human
Artikelnummer: BWT-BK0298
Hersteller Artikelnummer: BK0298
Alternativnummer: BWT-BK0298-10UG,BWT-BK0298-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-alpha, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with m
Molekulargewicht: 15~18 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.