RecombinantENA-78/CXCL5,Human(HEK293-expressed)

Artikelnummer: BWT-BK0302
Artikelname: RecombinantENA-78/CXCL5,Human(HEK293-expressed)
Artikelnummer: BWT-BK0302
Hersteller Artikelnummer: BK0302
Alternativnummer: BWT-BK0302-25UG,BWT-BK0302-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression
Molekulargewicht: 8.5 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.