RecombinantFasR,Human

Artikelnummer: BWT-BK0303
Artikelname: RecombinantFasR,Human
Artikelnummer: BWT-BK0303
Hersteller Artikelnummer: BK0303
Alternativnummer: BWT-BK0303-10UG,BWT-BK0303-1MG,BWT-BK0303-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspa
Molekulargewicht: 17~29 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.