RecombinantIL-1beta,Rat(HEK293-expressed)

Artikelnummer: BWT-BK0313
Artikelname: RecombinantIL-1beta,Rat(HEK293-expressed)
Artikelnummer: BWT-BK0313
Hersteller Artikelnummer: BK0313
Alternativnummer: BWT-BK0313-25UG,BWT-BK0313-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-1beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biolo
Molekulargewicht: 17~22 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.