RecombinantIL-4R,Human

Artikelnummer: BWT-BK0316
Artikelname: RecombinantIL-4R,Human
Artikelnummer: BWT-BK0316
Hersteller Artikelnummer: BK0316
Alternativnummer: BWT-BK0316-10UG,BWT-BK0316-1MG,BWT-BK0316-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with gamma chain to form the type I receptor for IL-4. The extracell
Molekulargewicht: 40-45 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL WAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.