RecombinantI-TAC/CXCL11,Human(HEK293-expressed)

Artikelnummer: BWT-BK0319
Artikelname: RecombinantI-TAC/CXCL11,Human(HEK293-expressed)
Artikelnummer: BWT-BK0319
Hersteller Artikelnummer: BK0319
Alternativnummer: BWT-BK0319-10UG,BWT-BK0319-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-
Molekulargewicht: 8.3 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100µg/ml.