RecombinantMCP-1/CCL2,Mouse

Artikelnummer: BWT-BK0320
Artikelname: RecombinantMCP-1/CCL2,Mouse
Artikelnummer: BWT-BK0320
Hersteller Artikelnummer: BK0320
Alternativnummer: BWT-BK0320-1MG,BWT-BK0320-25UG,BWT-BK0320-5UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic c
Molekulargewicht: 8 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.