RecombinantPF-4/CXCL4,Human

Artikelnummer: BWT-BK0328
Artikelname: RecombinantPF-4/CXCL4,Human
Artikelnummer: BWT-BK0328
Hersteller Artikelnummer: BK0328
Alternativnummer: BWT-BK0328-10UG,BWT-BK0328-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the alpha-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC c
Molekulargewicht: ~7.8 kDa, observed by non-reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.