RecombinantTRAILR-2,Human

Artikelnummer: BWT-BK0333
Artikelname: RecombinantTRAILR-2,Human
Artikelnummer: BWT-BK0333
Hersteller Artikelnummer: BK0333
Alternativnummer: BWT-BK0333-10UG,BWT-BK0333-1MG,BWT-BK0333-50UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
TRAIL Receptor-2 is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors
Molekulargewicht: ~15 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTR NTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.