Recombinant Human Angiostatin K1-3

Artikelnummer: BWT-PR1001
Artikelname: Recombinant Human Angiostatin K1-3
Artikelnummer: BWT-PR1001
Hersteller Artikelnummer: PR1001
Alternativnummer: BWT-PR1001-10UG,BWT-PR1001-50UG,BWT-PR1001-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.
Molekulargewicht: Approximately 30.0 KDa, a single non-glycosylated polypeptide chain containing 259 amino acids.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPS
Formel: Lyophilized from a 0.2µm filtered concentrated solution in 20mM NaAc, pH5.5, 4% mannitol.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio