Recombinant Human ENA-78(5-78a.a.) ( rHuENA-78(CXCL5))

Produktübersicht

• Artikelname: Recombinant Human ENA-78(5-78a.a.) ( rHuENA-78(CXCL5))
• Artikelnummer: BWT-PR1014
• Hersteller Artikelnummer: PR1014
• Alternativnummer: BWT-PR1014-5UG,BWT-PR1014-20UG,BWT-PR1014-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil c

Produkteigenschaften

• Molekulargewicht: 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• Quelle: Escherichia coli.
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio