Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)

Artikelnummer: BWT-PR1017
Artikelname: Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)
Artikelnummer: BWT-PR1017
Hersteller Artikelnummer: PR1017
Alternativnummer: BWT-PR1017-5UG,BWT-PR1017-20UG,BWT-PR1017-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Eotaxin, also named MPIF-2 and Ckbeta6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells
Molekulargewicht: 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio