Recombinant Human Fractalkine (rHuFractalkine/CX3CL1)

Produktübersicht

• Artikelname: Recombinant Human Fractalkine (rHuFractalkine/CX3CL1)
• Artikelnummer: BWT-PR1032
• Hersteller Artikelnummer: PR1032
• Alternativnummer: BWT-PR1032-5UG,BWT-PR1032-20UG,BWT-PR1032-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

Fractalkine, also named neurotactin, is a novel chemokine recently identified through bioinformatics. Fractalkine has a unique C-X3-C cysteine motif near the amino-terminus and is the first member of a fourth branch of the chemokine superfamily. Unlike o

Produkteigenschaften

• Molekulargewicht: 8.5 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Human Fractalkine.
• Quelle: Escherichia coli.
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio