Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )

Produktübersicht

• Artikelname: Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )
• Artikelnummer: BWT-PR1036
• Hersteller Artikelnummer: PR1036
• Alternativnummer: BWT-PR1036-5UG,BWT-PR1036-25UG,BWT-PR1036-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is indu

Produkteigenschaften

• Molekulargewicht: 7.8 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
• Quelle: Escherichia coli.
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio