Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2 )

Artikelnummer: BWT-PR1037
Artikelname: Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2 )
Artikelnummer: BWT-PR1037
Hersteller Artikelnummer: PR1037
Alternativnummer: BWT-PR1037-2UG,BWT-PR1037-10UG,BWT-PR1037-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is indu
Molekulargewicht: 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio