Recombinant Human HCC-4 (rHu HCC-4/CCL16)

Artikelnummer: BWT-PR1040
Artikelname: Recombinant Human HCC-4 (rHu HCC-4/CCL16)
Artikelnummer: BWT-PR1040
Hersteller Artikelnummer: PR1040
Alternativnummer: BWT-PR1040-5UG,BWT-PR1040-20UG,BWT-PR1040-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Human HCC-4, also named NCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine identified through bioinformatics. HCC-4 cDNA encodes a 120 amino acid (aa) residue precursor protein with a 23 aa
Molekulargewicht: 11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio