Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)

Artikelnummer: BWT-PR1079
Artikelname: Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)
Artikelnummer: BWT-PR1079
Hersteller Artikelnummer: PR1079
Alternativnummer: BWT-PR1079-2UG,BWT-PR1079-10UG,BWT-PR1079-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenat
Molekulargewicht: Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.
Quelle: Escherichia coli.
Reinheit: >96% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT
Formel: Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio