Recombinant Human MCP-2 (rHu MCP-2/CCL8)

Produktübersicht

• Artikelname: Recombinant Human MCP-2 (rHu MCP-2/CCL8)
• Artikelnummer: BWT-PR1087
• Hersteller Artikelnummer: PR1087
• Alternativnummer: BWT-PR1087-2UG,BWT-PR1087-10UG,BWT-PR1087-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shar

Produkteigenschaften

• Molekulargewicht: 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
• Quelle: Escherichia coli.
• Reinheit: >96% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio