Recombinant Human MCP-4 (rHuMCP-4/CCL13 )

Artikelnummer: BWT-PR1088
Artikelname: Recombinant Human MCP-4 (rHuMCP-4/CCL13 )
Artikelnummer: BWT-PR1088
Hersteller Artikelnummer: PR1088
Alternativnummer: BWT-PR1088-5UG,BWT-PR1088-20UG,BWT-PR1088-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most like
Molekulargewicht: 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Quelle: Escherichia coli.
Reinheit: >96% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio