Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage
• Artikelnummer: BWT-PR1093
• Hersteller Artikelnummer: PR1093
• Alternativnummer: BWT-PR1093-10UG,BWT-PR1093-50UG,BWT-PR1093-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

Human MIF consists of two alpha-helices and six beta-strands, four of which form a beta-sheet. The two remaining beta-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N-

Produkteigenschaften

• Molekulargewicht: Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.
• Quelle: Escherichia coli
• Reinheit: >95% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio